PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN04301.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 313aa    MW: 35476.5 Da    PI: 5.8032
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN04301.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.41e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEd +l+ +++++G+ +W+  +r  g+ R++k+c++rw++yl
       KHN04301.1 14 KGTWTPEEDAKLIAYITRYGSWNWRQLPRFAGLARCGKSCRLRWLNYL 61
                     799*******************************************97 PP

2Myb_DNA-binding58.91.2e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ T+eE+e++++++++lG++ W+ Ia +++ gRt++++k++w++ 
       KHN04301.1  67 RGNYTKEEEEIIIRLHEKLGNK-WSVIATHLP-GRTDNEIKNHWHTT 111
                      899*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.508961IPR017930Myb domain
SuperFamilySSF466891.52E-2911108IPR009057Homeodomain-like
SMARTSM007172.1E-101363IPR001005SANT/Myb domain
PfamPF002491.9E-131461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.3E-231568IPR009057Homeodomain-like
CDDcd001678.49E-91661No hitNo description
PROSITE profilePS5129426.51862116IPR017930Myb domain
SMARTSM007174.3E-1866114IPR001005SANT/Myb domain
PfamPF002498.1E-1767111IPR001005SANT/Myb domain
CDDcd001673.93E-1369112No hitNo description
Gene3DG3DSA:1.10.10.604.2E-2669115IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MRTPSSSHKS GLNKGTWTPE EDAKLIAYIT RYGSWNWRQL PRFAGLARCG KSCRLRWLNY  60
LRPNIKRGNY TKEEEEIIIR LHEKLGNKWS VIATHLPGRT DNEIKNHWHT TLKKRFGKNT  120
VHPNKKMKAT KSNSSGSKQI QNVGFFHSSS TITTSETSDS VPLSPREFSS TTSDYTTVVT  180
NENFLLEDGF DFLEACLEDV NENIWTETNA ASISNSKTPM LDNGNGSNFH GSDAAGPIME  240
YNENLVLEND EFAFLEALQP TVTTENFLTD MSLVPNELLA PLVNESEEYF SSLYDVDLWC  300
PSNFHDLHVG LLQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-291211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150402e-41AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003540332.20.0PREDICTED: myb-related protein 308-like
TrEMBLA0A0B2P4X00.0A0A0B2P4X0_GLYSO; Myb-related protein Zm1
STRINGGLYMA12G32541.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1674767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.16e-53myb domain protein 14
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]